Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4312879..4313714 | Replicon | chromosome |
| Accession | NZ_CP113503 | ||
| Organism | Escherichia coli strain 16843 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2S4A272 |
| Locus tag | OWO50_RS20750 | Protein ID | WP_001094443.1 |
| Coordinates | 4312879..4313256 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q1R2L5 |
| Locus tag | OWO50_RS20755 | Protein ID | WP_001285575.1 |
| Coordinates | 4313346..4313714 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWO50_RS20725 (4308383) | 4308383..4308562 | + | 180 | Protein_4068 | peptidase | - |
| OWO50_RS20730 (4308961) | 4308961..4310997 | - | 2037 | WP_000417001.1 | hypothetical protein | - |
| OWO50_RS20735 (4311952) | 4311952..4312101 | - | 150 | Protein_4070 | hypothetical protein | - |
| OWO50_RS20740 (4312185) | 4312185..4312382 | - | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| OWO50_RS20745 (4312394) | 4312394..4312882 | - | 489 | WP_268051967.1 | DUF5983 family protein | - |
| OWO50_RS20750 (4312879) | 4312879..4313256 | - | 378 | WP_001094443.1 | TA system toxin CbtA family protein | Toxin |
| OWO50_RS20755 (4313346) | 4313346..4313714 | - | 369 | WP_001285575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OWO50_RS20760 (4313794) | 4313794..4314015 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| OWO50_RS20765 (4314102) | 4314102..4314578 | - | 477 | WP_001298074.1 | RadC family protein | - |
| OWO50_RS20770 (4314593) | 4314593..4315078 | - | 486 | WP_000213697.1 | antirestriction protein | - |
| OWO50_RS20775 (4315169) | 4315169..4315987 | - | 819 | WP_001175160.1 | DUF932 domain-containing protein | - |
| OWO50_RS20780 (4316077) | 4316077..4316310 | - | 234 | WP_001278290.1 | DUF905 family protein | - |
| OWO50_RS20785 (4316316) | 4316316..4316993 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| OWO50_RS20790 (4317141) | 4317141..4317821 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4302299..4329547 | 27248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T265836 WP_001094443.1 NZ_CP113503:c4313256-4312879 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13709.52 Da Isoelectric Point: 6.6258
>AT265836 WP_001285575.1 NZ_CP113503:c4313714-4313346 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4A272 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABF5 |