Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4110103..4110653 Replicon chromosome
Accession NZ_CP113503
Organism Escherichia coli strain 16843

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag OWO50_RS19700 Protein ID WP_001160966.1
Coordinates 4110103..4110417 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag OWO50_RS19705 Protein ID WP_000125568.1
Coordinates 4110420..4110653 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWO50_RS19675 (4105778) 4105778..4107064 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
OWO50_RS19680 (4107064) 4107064..4108053 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
OWO50_RS19685 (4108050) 4108050..4108871 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
OWO50_RS19690 (4108874) 4108874..4109251 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
OWO50_RS19695 (4109258) 4109258..4110106 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
OWO50_RS19700 (4110103) 4110103..4110417 - 315 WP_001160966.1 CcdB family protein Toxin
OWO50_RS19705 (4110420) 4110420..4110653 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OWO50_RS19710 (4110739) 4110739..4111218 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
OWO50_RS19715 (4111410) 4111410..4113272 - 1863 WP_139554680.1 glutathione-regulated potassium-efflux system protein KefC -
OWO50_RS19720 (4113265) 4113265..4113795 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
OWO50_RS19725 (4113903) 4113903..4115234 - 1332 WP_001183198.1 MFS transporter -
OWO50_RS19730 (4115293) 4115293..4115580 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T265830 WP_001160966.1 NZ_CP113503:c4110417-4110103 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT265830 WP_000125568.1 NZ_CP113503:c4110653-4110420 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References