Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3795639..3796474 | Replicon | chromosome |
| Accession | NZ_CP113503 | ||
| Organism | Escherichia coli strain 16843 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q83W73 |
| Locus tag | OWO50_RS18225 | Protein ID | WP_000854700.1 |
| Coordinates | 3795639..3796016 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | OWO50_RS18230 | Protein ID | WP_001278232.1 |
| Coordinates | 3796106..3796474 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWO50_RS18195 (3790961) | 3790961..3791455 | + | 495 | WP_001059463.1 | MarR family transcriptional regulator | - |
| OWO50_RS18200 (3791893) | 3791893..3792228 | - | 336 | Protein_3573 | Arm DNA-binding domain-containing protein | - |
| OWO50_RS18205 (3792594) | 3792594..3793913 | + | 1320 | WP_000144686.1 | site-specific integrase | - |
| OWO50_RS18210 (3794006) | 3794006..3794860 | - | 855 | WP_024174313.1 | DUF4942 domain-containing protein | - |
| OWO50_RS18215 (3794945) | 3794945..3795142 | - | 198 | WP_000839247.1 | DUF957 domain-containing protein | - |
| OWO50_RS18220 (3795154) | 3795154..3795642 | - | 489 | WP_000761726.1 | DUF5983 family protein | - |
| OWO50_RS18225 (3795639) | 3795639..3796016 | - | 378 | WP_000854700.1 | TA system toxin CbtA family protein | Toxin |
| OWO50_RS18230 (3796106) | 3796106..3796474 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| OWO50_RS18235 (3796637) | 3796637..3796858 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| OWO50_RS18240 (3796927) | 3796927..3797403 | - | 477 | WP_001186199.1 | RadC family protein | - |
| OWO50_RS18245 (3797419) | 3797419..3797904 | - | 486 | WP_000213723.1 | antirestriction protein | - |
| OWO50_RS18250 (3797996) | 3797996..3798814 | - | 819 | WP_001234709.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE / vat / vat | 3743659..3824373 | 80714 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14276.28 Da Isoelectric Point: 7.8046
>T265828 WP_000854700.1 NZ_CP113503:c3796016-3795639 [Escherichia coli]
MKTLPDTHVREASRCLSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SPCTRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MKTLPDTHVREASRCLSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SPCTRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT265828 WP_001278232.1 NZ_CP113503:c3796474-3796106 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A1I2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |