Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3601528..3602146 | Replicon | chromosome |
Accession | NZ_CP113503 | ||
Organism | Escherichia coli strain 16843 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | OWO50_RS17315 | Protein ID | WP_001291435.1 |
Coordinates | 3601928..3602146 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | OWO50_RS17310 | Protein ID | WP_000344800.1 |
Coordinates | 3601528..3601902 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWO50_RS17300 (3596617) | 3596617..3597810 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OWO50_RS17305 (3597833) | 3597833..3600983 | + | 3151 | Protein_3395 | efflux RND transporter permease AcrB | - |
OWO50_RS17310 (3601528) | 3601528..3601902 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
OWO50_RS17315 (3601928) | 3601928..3602146 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
OWO50_RS17320 (3602320) | 3602320..3602871 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
OWO50_RS17325 (3602987) | 3602987..3603457 | + | 471 | WP_000136192.1 | YlaC family protein | - |
OWO50_RS17330 (3603621) | 3603621..3605171 | + | 1551 | WP_001298569.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OWO50_RS17335 (3605213) | 3605213..3605566 | - | 354 | WP_000878138.1 | DUF1428 family protein | - |
OWO50_RS17345 (3605945) | 3605945..3606256 | + | 312 | WP_000409908.1 | MGMT family protein | - |
OWO50_RS17350 (3606287) | 3606287..3606859 | - | 573 | WP_000779830.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T265827 WP_001291435.1 NZ_CP113503:3601928-3602146 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT265827 WP_000344800.1 NZ_CP113503:3601528-3601902 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |