Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1979239..1980070 Replicon chromosome
Accession NZ_CP113503
Organism Escherichia coli strain 16843

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag OWO50_RS09310 Protein ID WP_000854814.1
Coordinates 1979239..1979613 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag OWO50_RS09315 Protein ID WP_024174331.1
Coordinates 1979702..1980070 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWO50_RS09270 (1974635) 1974635..1975801 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
OWO50_RS09275 (1975920) 1975920..1976393 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
OWO50_RS09280 (1976591) 1976591..1977649 + 1059 WP_001200890.1 FUSC family protein -
OWO50_RS09285 (1977821) 1977821..1978150 + 330 WP_000450409.1 DUF496 family protein -
OWO50_RS09290 (1978251) 1978251..1978574 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
OWO50_RS09295 (1978553) 1978553..1978633 + 81 WP_023441679.1 hypothetical protein -
OWO50_RS09300 (1978922) 1978922..1979002 - 81 Protein_1826 hypothetical protein -
OWO50_RS09305 (1979048) 1979048..1979242 - 195 WP_000988601.1 DUF5983 family protein -
OWO50_RS09310 (1979239) 1979239..1979613 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
OWO50_RS09315 (1979702) 1979702..1980070 - 369 WP_024174331.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OWO50_RS09320 (1980144) 1980144..1980365 - 222 WP_000692346.1 DUF987 domain-containing protein -
OWO50_RS09325 (1980434) 1980434..1980910 - 477 WP_001541535.1 RadC family protein -
OWO50_RS09330 (1980926) 1980926..1981399 - 474 WP_000855074.1 antirestriction protein -
OWO50_RS09335 (1981662) 1981662..1982483 - 822 WP_001234571.1 DUF932 domain-containing protein -
OWO50_RS09340 (1982704) 1982704..1983114 - 411 WP_000846704.1 hypothetical protein -
OWO50_RS09345 (1983130) 1983130..1983807 - 678 WP_001362823.1 hypothetical protein -
OWO50_RS09350 (1983943) 1983943..1985013 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T265819 WP_000854814.1 NZ_CP113503:c1979613-1979239 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13603.42 Da        Isoelectric Point: 6.7386

>AT265819 WP_024174331.1 NZ_CP113503:c1980070-1979702 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References