Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1191883..1192466 | Replicon | chromosome |
Accession | NZ_CP113503 | ||
Organism | Escherichia coli strain 16843 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | OWO50_RS05710 | Protein ID | WP_000254749.1 |
Coordinates | 1192131..1192466 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | OWO50_RS05705 | Protein ID | WP_000581937.1 |
Coordinates | 1191883..1192131 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWO50_RS05695 (1188222) | 1188222..1189523 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
OWO50_RS05700 (1189571) | 1189571..1191805 | + | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
OWO50_RS05705 (1191883) | 1191883..1192131 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OWO50_RS05710 (1192131) | 1192131..1192466 | + | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
OWO50_RS05715 (1192538) | 1192538..1193329 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OWO50_RS05720 (1193557) | 1193557..1195194 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OWO50_RS05725 (1195282) | 1195282..1196580 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T265817 WP_000254749.1 NZ_CP113503:1192131-1192466 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|