Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1024012..1024666 | Replicon | chromosome |
Accession | NZ_CP113503 | ||
Organism | Escherichia coli strain 16843 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | OWO50_RS05025 | Protein ID | WP_000244765.1 |
Coordinates | 1024259..1024666 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OWO50_RS05020 | Protein ID | WP_000354046.1 |
Coordinates | 1024012..1024278 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWO50_RS05000 (1020100) | 1020100..1021533 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
OWO50_RS05005 (1021578) | 1021578..1021889 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
OWO50_RS05010 (1022053) | 1022053..1022712 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
OWO50_RS05015 (1022789) | 1022789..1023769 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
OWO50_RS05020 (1024012) | 1024012..1024278 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OWO50_RS05025 (1024259) | 1024259..1024666 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
OWO50_RS05030 (1024706) | 1024706..1025227 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
OWO50_RS05035 (1025339) | 1025339..1026235 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OWO50_RS05040 (1026260) | 1026260..1026970 | + | 711 | WP_000715229.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OWO50_RS05045 (1026976) | 1026976..1028709 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T265816 WP_000244765.1 NZ_CP113503:1024259-1024666 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |