Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 874910..875742 | Replicon | chromosome |
| Accession | NZ_CP113503 | ||
| Organism | Escherichia coli strain 16843 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | OWO50_RS04255 | Protein ID | WP_000854753.1 |
| Coordinates | 874910..875284 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | OWO50_RS04260 | Protein ID | WP_001278232.1 |
| Coordinates | 875374..875742 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWO50_RS04225 (870027) | 870027..871174 | - | 1148 | Protein_831 | capsule biosynthesis protein | - |
| OWO50_RS04230 (871246) | 871246..872229 | - | 984 | WP_001335608.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| OWO50_RS04235 (873039) | 873039..873209 | - | 171 | Protein_833 | IS110 family transposase | - |
| OWO50_RS04240 (873551) | 873551..874120 | - | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| OWO50_RS04245 (874216) | 874216..874413 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| OWO50_RS04250 (874425) | 874425..874913 | - | 489 | WP_000777541.1 | DUF5983 family protein | - |
| OWO50_RS04255 (874910) | 874910..875284 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| OWO50_RS04260 (875374) | 875374..875742 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| OWO50_RS04265 (875905) | 875905..876126 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| OWO50_RS04270 (876189) | 876189..876665 | - | 477 | WP_001186726.1 | RadC family protein | - |
| OWO50_RS04275 (876681) | 876681..877166 | - | 486 | WP_001531954.1 | antirestriction protein | - |
| OWO50_RS04280 (877221) | 877221..878042 | - | 822 | WP_001531953.1 | DUF932 domain-containing protein | - |
| OWO50_RS04285 (878220) | 878220..878309 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| OWO50_RS04290 (878452) | 878452..878907 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 873039..873143 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T265815 WP_000854753.1 NZ_CP113503:c875284-874910 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT265815 WP_001278232.1 NZ_CP113503:c875742-875374 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |