Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 45306..46141 Replicon chromosome
Accession NZ_CP113503
Organism Escherichia coli strain 16843

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2S4A272
Locus tag OWO50_RS00230 Protein ID WP_001094443.1
Coordinates 45306..45683 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID Q1R2L5
Locus tag OWO50_RS00235 Protein ID WP_001285575.1
Coordinates 45773..46141 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWO50_RS00200 (40678) 40678..41496 + 819 WP_000779409.1 lipoprotein NlpA -
OWO50_RS00205 (41500) 41500..42423 - 924 WP_001351210.1 carboxylate/amino acid/amine transporter -
OWO50_RS00210 (42720) 42720..43088 - 369 WP_000509807.1 hypothetical protein -
OWO50_RS00215 (43684) 43684..44523 - 840 WP_053285928.1 DUF4942 domain-containing protein -
OWO50_RS00220 (44664) 44664..44804 - 141 WP_064755228.1 DUF957 domain-containing protein -
OWO50_RS00225 (44821) 44821..45309 - 489 WP_053285927.1 DUF5983 family protein -
OWO50_RS00230 (45306) 45306..45683 - 378 WP_001094443.1 TA system toxin CbtA family protein Toxin
OWO50_RS00235 (45773) 45773..46141 - 369 WP_001285575.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OWO50_RS00240 (46221) 46221..46442 - 222 WP_000692350.1 DUF987 domain-containing protein -
OWO50_RS00245 (46529) 46529..47005 - 477 WP_001298074.1 RadC family protein -
OWO50_RS00250 (47020) 47020..47505 - 486 WP_000213697.1 antirestriction protein -
OWO50_RS00255 (47596) 47596..48414 - 819 WP_001175160.1 DUF932 domain-containing protein -
OWO50_RS00260 (48504) 48504..48737 - 234 WP_001278290.1 DUF905 family protein -
OWO50_RS00265 (48743) 48743..49420 - 678 WP_001097301.1 hypothetical protein -
OWO50_RS00270 (49568) 49568..50248 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14058.97 Da        Isoelectric Point: 7.3523

>T265812 WP_001094443.1 NZ_CP113503:c45683-45306 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13709.52 Da        Isoelectric Point: 6.6258

>AT265812 WP_001285575.1 NZ_CP113503:c46141-45773 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4A272

Antitoxin

Source ID Structure
AlphaFold DB A0A454ABF5

References