Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 787684..788245 | Replicon | chromosome |
Accession | NZ_CP113500 | ||
Organism | Mycoplasma feriruminatoris strain L15568 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI15568_RS03425 | Protein ID | WP_278307858.1 |
Coordinates | 787684..787980 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L5LA09 |
Locus tag | MFERI15568_RS03430 | Protein ID | WP_008362623.1 |
Coordinates | 787973..788245 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI15568_RS03405 (MFERI15568_00677) | 782784..783413 | + | 630 | WP_278299862.1 | beta-phosphoglucomutase | - |
MFERI15568_RS03410 (MFERI15568_00678) | 783520..785196 | + | 1677 | WP_278307856.1 | LppA family lipoprotein | - |
MFERI15568_RS03415 (MFERI15568_00679) | 785224..786105 | - | 882 | WP_278287772.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI15568_RS03420 (MFERI15568_00680) | 786354..787649 | + | 1296 | WP_278307857.1 | ATP-binding protein | - |
MFERI15568_RS03425 (MFERI15568_00681) | 787684..787980 | - | 297 | WP_278307858.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI15568_RS03430 (MFERI15568_00682) | 787973..788245 | - | 273 | WP_008362623.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI15568_RS03435 (MFERI15568_00683) | 788429..789598 | - | 1170 | WP_278307859.1 | site-specific DNA-methyltransferase | - |
MFERI15568_RS03440 (MFERI15568_00684) | 789758..792868 | - | 3111 | WP_278307860.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11498.45 Da Isoelectric Point: 9.8106
>T265811 WP_278307858.1 NZ_CP113500:c787980-787684 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKEYRECHIDPDFLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKEYRECHIDPDFLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|