Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 786398..786959 | Replicon | chromosome |
Accession | NZ_CP113498 | ||
Organism | Mycoplasma feriruminatoris strain L15181 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI15181_RS03420 | Protein ID | WP_278299865.1 |
Coordinates | 786398..786694 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L5LA09 |
Locus tag | MFERI15181_RS03425 | Protein ID | WP_008362623.1 |
Coordinates | 786687..786959 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI15181_RS03405 (MFERI15181_00676) | 782237..783910 | + | 1674 | WP_278299863.1 | LppA family lipoprotein | - |
MFERI15181_RS03410 (MFERI15181_00677) | 783938..784819 | - | 882 | WP_278287772.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI15181_RS03415 (MFERI15181_00678) | 785068..786363 | + | 1296 | WP_278299864.1 | ATP-binding protein | - |
MFERI15181_RS03420 (MFERI15181_00679) | 786398..786694 | - | 297 | WP_278299865.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI15181_RS03425 (MFERI15181_00680) | 786687..786959 | - | 273 | WP_008362623.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI15181_RS03430 (MFERI15181_00681) | 787143..788117 | - | 975 | WP_278300168.1 | site-specific DNA-methyltransferase | - |
MFERI15181_RS03435 (MFERI15181_00683) | 788467..791604 | - | 3138 | WP_278299866.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11498.45 Da Isoelectric Point: 9.8106
>T265809 WP_278299865.1 NZ_CP113498:c786694-786398 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSFTGIYKEYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSFTGIYKEYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|