Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 792812..793373 | Replicon | chromosome |
Accession | NZ_CP113497 | ||
Organism | Mycoplasma feriruminatoris strain L14815 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI14815_RS03430 | Protein ID | WP_278287774.1 |
Coordinates | 792812..793108 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L5LA09 |
Locus tag | MFERI14815_RS03435 | Protein ID | WP_008362623.1 |
Coordinates | 793101..793373 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI14815_RS03415 (MFERI14815_00682) | 788651..790324 | + | 1674 | WP_278288780.1 | LppA family lipoprotein | - |
MFERI14815_RS03420 (MFERI14815_00683) | 790352..791233 | - | 882 | WP_278288311.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI14815_RS03425 (MFERI14815_00684) | 791482..792777 | + | 1296 | WP_278288781.1 | ATP-binding protein | - |
MFERI14815_RS03430 (MFERI14815_00685) | 792812..793108 | - | 297 | WP_278287774.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI14815_RS03435 (MFERI14815_00686) | 793101..793373 | - | 273 | WP_008362623.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI14815_RS03440 (MFERI14815_00687) | 793557..794726 | - | 1170 | WP_278288782.1 | site-specific DNA-methyltransferase | - |
MFERI14815_RS03445 (MFERI14815_00688) | 794716..795360 | - | 645 | WP_278288783.1 | ApaLI family restriction endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11452.38 Da Isoelectric Point: 9.8106
>T265808 WP_278287774.1 NZ_CP113497:c793108-792812 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILTQGKELDAKYQDHSLTGIYKEYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILTQGKELDAKYQDHSLTGIYKEYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|