Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 791655..792261 | Replicon | chromosome |
Accession | NZ_CP113496 | ||
Organism | Mycoplasma feriruminatoris strain L13461 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI13461_RS03435 | Protein ID | WP_278299456.1 |
Coordinates | 791655..791996 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L5LA09 |
Locus tag | MFERI13461_RS03440 | Protein ID | WP_008362623.1 |
Coordinates | 791989..792261 (-) | Length | 91 a.a. |
Genomic Context
Location: 788882..790177 (1296 bp)
Type: Others
Protein ID: WP_278299455.1
Type: Others
Protein ID: WP_278299455.1
Location: 790246..791658 (1413 bp)
Type: Others
Protein ID: Protein_648
Type: Others
Protein ID: Protein_648
Location: 787752..788633 (882 bp)
Type: Others
Protein ID: WP_278299454.1
Type: Others
Protein ID: WP_278299454.1
Location: 791655..791996 (342 bp)
Type: Toxin
Protein ID: WP_278299456.1
Type: Toxin
Protein ID: WP_278299456.1
Location: 791989..792261 (273 bp)
Type: Antitoxin
Protein ID: WP_008362623.1
Type: Antitoxin
Protein ID: WP_008362623.1
Location: 792445..792570 (126 bp)
Type: Others
Protein ID: WP_278299457.1
Type: Others
Protein ID: WP_278299457.1
Location: 792647..795733 (3087 bp)
Type: Others
Protein ID: WP_278299458.1
Type: Others
Protein ID: WP_278299458.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI13461_RS03420 (MFERI13461_00683) | 787752..788633 | - | 882 | WP_278299454.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI13461_RS03425 (MFERI13461_00684) | 788882..790177 | + | 1296 | WP_278299455.1 | ATP-binding protein | - |
MFERI13461_RS03430 | 790246..791658 | + | 1413 | Protein_648 | IS3 family transposase | - |
MFERI13461_RS03435 (MFERI13461_00687) | 791655..791996 | - | 342 | WP_278299456.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI13461_RS03440 (MFERI13461_00688) | 791989..792261 | - | 273 | WP_008362623.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI13461_RS03445 | 792445..792570 | - | 126 | WP_278299457.1 | hypothetical protein | - |
MFERI13461_RS03450 (MFERI13461_00690) | 792647..795733 | - | 3087 | WP_278299458.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13114.35 Da Isoelectric Point: 10.0681
>T265807 WP_278299456.1 NZ_CP113496:c791996-791655 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKEYRECHIDPDFLIYKKDDDKIVIIM
LRLGSHSNLFEKQKTTRLNKKQLPPATINTD
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKEYRECHIDPDFLIYKKDDDKIVIIM
LRLGSHSNLFEKQKTTRLNKKQLPPATINTD
Download Length: 342 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | L5LA09 |