Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 784894..785455 | Replicon | chromosome |
Accession | NZ_CP113495 | ||
Organism | Mycoplasma feriruminatoris strain F11561 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI11561_RS03440 | Protein ID | WP_278288313.1 |
Coordinates | 784894..785190 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L5LA09 |
Locus tag | MFERI11561_RS03445 | Protein ID | WP_008362623.1 |
Coordinates | 785183..785455 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI11561_RS03425 (MFERI11561_00678) | 780766..782406 | + | 1641 | WP_278288310.1 | LppA family lipoprotein | - |
MFERI11561_RS03430 (MFERI11561_00679) | 782434..783315 | - | 882 | WP_278288311.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI11561_RS03435 (MFERI11561_00680) | 783564..784859 | + | 1296 | WP_278288312.1 | ATP-binding protein | - |
MFERI11561_RS03440 (MFERI11561_00681) | 784894..785190 | - | 297 | WP_278288313.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI11561_RS03445 (MFERI11561_00682) | 785183..785455 | - | 273 | WP_008362623.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI11561_RS03450 (MFERI11561_00683) | 785640..786809 | - | 1170 | WP_278288314.1 | site-specific DNA-methyltransferase | - |
MFERI11561_RS03455 (MFERI11561_00684) | 786965..790078 | - | 3114 | WP_278288315.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11463.49 Da Isoelectric Point: 10.0351
>T265806 WP_278288313.1 NZ_CP113495:c785190-784894 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKKYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKKYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|