Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5172..5731 Replicon plasmid unnamed1
Accession NZ_CP113494
Organism Escherichia coli strain GTEN_97

Toxin (Protein)


Gene name relE Uniprot ID G4VUF8
Locus tag E5R32_RS25220 Protein ID WP_000421273.1
Coordinates 5172..5447 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag E5R32_RS25225 Protein ID WP_001387467.1
Coordinates 5447..5731 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5R32_RS25185 (1221) 1221..1961 - 741 WP_001066941.1 tyrosine-type recombinase/integrase -
E5R32_RS25190 (2082) 2082..2264 - 183 WP_042344623.1 hypothetical protein -
E5R32_RS25195 (2331) 2331..2621 - 291 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
E5R32_RS25200 (2608) 2608..2876 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
E5R32_RS25205 (3408) 3408..4577 + 1170 WP_001403369.1 hypothetical protein -
E5R32_RS25210 (4610) 4610..4738 + 129 Protein_6 IS481 family transposase -
E5R32_RS25215 (4863) 4863..5066 - 204 Protein_7 hypothetical protein -
E5R32_RS25220 (5172) 5172..5447 - 276 WP_000421273.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
E5R32_RS25225 (5447) 5447..5731 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
E5R32_RS25230 (6336) 6336..7088 + 753 WP_001403368.1 IclR family transcriptional regulator -
E5R32_RS25235 (7134) 7134..8099 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
E5R32_RS25240 (8132) 8132..8512 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
E5R32_RS25245 (8537) 8537..9427 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
E5R32_RS25250 (9780) 9780..10346 + 567 Protein_14 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 - 1..148685 148685


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10765.45 Da        Isoelectric Point: 9.9324

>T265802 WP_000421273.1 NZ_CP113494:c5447-5172 [Escherichia coli]
MELKWTSKALSDLSRLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT265802 WP_001387467.1 NZ_CP113494:c5731-5447 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y6H1

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References