Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4706223..4707058 | Replicon | chromosome |
| Accession | NZ_CP113493 | ||
| Organism | Escherichia coli strain GTEN_97 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | E5R32_RS22855 | Protein ID | WP_001564063.1 |
| Coordinates | 4706681..4707058 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K5N986 |
| Locus tag | E5R32_RS22850 | Protein ID | WP_021553056.1 |
| Coordinates | 4706223..4706591 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5R32_RS22815 (4701882) | 4701882..4702562 | + | 681 | WP_001278649.1 | WYL domain-containing protein | - |
| E5R32_RS22820 (4702713) | 4702713..4703390 | + | 678 | WP_001564058.1 | hypothetical protein | - |
| E5R32_RS22825 (4703396) | 4703396..4703629 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| E5R32_RS22830 (4703719) | 4703719..4704537 | + | 819 | WP_001564059.1 | DUF932 domain-containing protein | - |
| E5R32_RS22835 (4704803) | 4704803..4705282 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| E5R32_RS22840 (4705298) | 4705298..4705774 | + | 477 | WP_021553055.1 | RadC family protein | - |
| E5R32_RS22845 (4705839) | 4705839..4706060 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| E5R32_RS22850 (4706223) | 4706223..4706591 | + | 369 | WP_021553056.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E5R32_RS22855 (4706681) | 4706681..4707058 | + | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| E5R32_RS22860 (4707055) | 4707055..4707204 | + | 150 | Protein_4473 | DUF5983 family protein | - |
| E5R32_RS22865 (4707283) | 4707283..4707477 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| E5R32_RS22870 (4707562) | 4707562..4708404 | + | 843 | Protein_4475 | DUF4942 domain-containing protein | - |
| E5R32_RS22875 (4709154) | 4709154..4710692 | + | 1539 | WP_059332368.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4672661..4718505 | 45844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T265799 WP_001564063.1 NZ_CP113493:4706681-4707058 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13615.39 Da Isoelectric Point: 7.0264
>AT265799 WP_021553056.1 NZ_CP113493:4706223-4706591 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K5N986 |