Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4631571..4632366 | Replicon | chromosome |
| Accession | NZ_CP113493 | ||
| Organism | Escherichia coli strain GTEN_97 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | E5R32_RS22430 | Protein ID | WP_268101587.1 |
| Coordinates | 4631992..4632366 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A4Y9BHM8 |
| Locus tag | E5R32_RS22425 | Protein ID | WP_023909483.1 |
| Coordinates | 4631571..4631945 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5R32_RS22390 (4626733) | 4626733..4627551 | + | 819 | WP_001522287.1 | DUF932 domain-containing protein | - |
| E5R32_RS22395 (4627551) | 4627551..4627727 | + | 177 | WP_001522285.1 | hypothetical protein | - |
| E5R32_RS22400 (4627822) | 4627822..4628295 | + | 474 | WP_001522284.1 | antirestriction protein | - |
| E5R32_RS22405 (4628310) | 4628310..4628786 | + | 477 | WP_001186724.1 | RadC family protein | - |
| E5R32_RS22410 (4628967) | 4628967..4630466 | + | 1500 | WP_059332257.1 | IS21-like element ISEc10 family transposase | - |
| E5R32_RS22415 (4630463) | 4630463..4631218 | + | 756 | WP_001522280.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| E5R32_RS22420 (4631270) | 4631270..4631491 | + | 222 | WP_023909484.1 | DUF987 domain-containing protein | - |
| E5R32_RS22425 (4631571) | 4631571..4631945 | + | 375 | WP_023909483.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| E5R32_RS22430 (4631992) | 4631992..4632366 | + | 375 | WP_268101587.1 | TA system toxin CbtA family protein | Toxin |
| E5R32_RS22435 (4632363) | 4632363..4632854 | + | 492 | WP_023909481.1 | DUF5983 family protein | - |
| E5R32_RS22440 (4632866) | 4632866..4633063 | + | 198 | WP_001522268.1 | DUF957 domain-containing protein | - |
| E5R32_RS22445 (4633148) | 4633148..4634014 | + | 867 | WP_023909479.1 | DUF4942 domain-containing protein | - |
| E5R32_RS22450 (4634086) | 4634086..4634349 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| E5R32_RS22455 (4634346) | 4634346..4634672 | + | 327 | WP_001522265.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| E5R32_RS22460 (4635136) | 4635136..4636401 | + | 1266 | WP_001218869.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | papX | 4623294..4667345 | 44051 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14020.02 Da Isoelectric Point: 8.2905
>T265798 WP_268101587.1 NZ_CP113493:4631992-4632366 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRPQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRPQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13598.31 Da Isoelectric Point: 5.5051
>AT265798 WP_023909483.1 NZ_CP113493:4631571-4631945 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|