Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4631571..4632366 Replicon chromosome
Accession NZ_CP113493
Organism Escherichia coli strain GTEN_97

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag E5R32_RS22430 Protein ID WP_268101587.1
Coordinates 4631992..4632366 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A4Y9BHM8
Locus tag E5R32_RS22425 Protein ID WP_023909483.1
Coordinates 4631571..4631945 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5R32_RS22390 (4626733) 4626733..4627551 + 819 WP_001522287.1 DUF932 domain-containing protein -
E5R32_RS22395 (4627551) 4627551..4627727 + 177 WP_001522285.1 hypothetical protein -
E5R32_RS22400 (4627822) 4627822..4628295 + 474 WP_001522284.1 antirestriction protein -
E5R32_RS22405 (4628310) 4628310..4628786 + 477 WP_001186724.1 RadC family protein -
E5R32_RS22410 (4628967) 4628967..4630466 + 1500 WP_059332257.1 IS21-like element ISEc10 family transposase -
E5R32_RS22415 (4630463) 4630463..4631218 + 756 WP_001522280.1 IS21-like element ISEc10 family helper ATPase IstB -
E5R32_RS22420 (4631270) 4631270..4631491 + 222 WP_023909484.1 DUF987 domain-containing protein -
E5R32_RS22425 (4631571) 4631571..4631945 + 375 WP_023909483.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
E5R32_RS22430 (4631992) 4631992..4632366 + 375 WP_268101587.1 TA system toxin CbtA family protein Toxin
E5R32_RS22435 (4632363) 4632363..4632854 + 492 WP_023909481.1 DUF5983 family protein -
E5R32_RS22440 (4632866) 4632866..4633063 + 198 WP_001522268.1 DUF957 domain-containing protein -
E5R32_RS22445 (4633148) 4633148..4634014 + 867 WP_023909479.1 DUF4942 domain-containing protein -
E5R32_RS22450 (4634086) 4634086..4634349 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
E5R32_RS22455 (4634346) 4634346..4634672 + 327 WP_001522265.1 type II toxin-antitoxin system RelE/ParE family toxin -
E5R32_RS22460 (4635136) 4635136..4636401 + 1266 WP_001218869.1 integrase arm-type DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - papX 4623294..4667345 44051


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14020.02 Da        Isoelectric Point: 8.2905

>T265798 WP_268101587.1 NZ_CP113493:4631992-4632366 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRPQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13598.31 Da        Isoelectric Point: 5.5051

>AT265798 WP_023909483.1 NZ_CP113493:4631571-4631945 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y9BHM8

References