Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4505948..4506602 | Replicon | chromosome |
Accession | NZ_CP113493 | ||
Organism | Escherichia coli strain GTEN_97 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | E5R32_RS21785 | Protein ID | WP_000244781.1 |
Coordinates | 4505948..4506355 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0V9GG32 |
Locus tag | E5R32_RS21790 | Protein ID | WP_001564007.1 |
Coordinates | 4506336..4506602 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5R32_RS21765 (4501905) | 4501905..4503638 | - | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
E5R32_RS21770 (4503644) | 4503644..4504354 | - | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
E5R32_RS21775 (4504379) | 4504379..4505275 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
E5R32_RS21780 (4505387) | 4505387..4505908 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
E5R32_RS21785 (4505948) | 4505948..4506355 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
E5R32_RS21790 (4506336) | 4506336..4506602 | - | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
E5R32_RS21795 (4506845) | 4506845..4507825 | + | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
E5R32_RS21800 (4507902) | 4507902..4508561 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
E5R32_RS21805 (4508725) | 4508725..4509036 | - | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
E5R32_RS21810 (4509081) | 4509081..4510514 | + | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T265797 WP_000244781.1 NZ_CP113493:c4506355-4505948 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9GG32 |