Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 4359273..4359856 | Replicon | chromosome |
Accession | NZ_CP113493 | ||
Organism | Escherichia coli strain GTEN_97 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | E5R32_RS21120 | Protein ID | WP_000254738.1 |
Coordinates | 4359273..4359608 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | E5R32_RS21125 | Protein ID | WP_000581937.1 |
Coordinates | 4359608..4359856 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5R32_RS21105 (4355159) | 4355159..4356457 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
E5R32_RS21110 (4356545) | 4356545..4358182 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
E5R32_RS21115 (4358410) | 4358410..4359201 | - | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
E5R32_RS21120 (4359273) | 4359273..4359608 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
E5R32_RS21125 (4359608) | 4359608..4359856 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
E5R32_RS21130 (4359934) | 4359934..4362168 | - | 2235 | WP_001551562.1 | GTP diphosphokinase | - |
E5R32_RS21135 (4362216) | 4362216..4363517 | - | 1302 | WP_001551563.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T265796 WP_000254738.1 NZ_CP113493:c4359608-4359273 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|