Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1106731..1107566 | Replicon | chromosome |
| Accession | NZ_CP113493 | ||
| Organism | Escherichia coli strain GTEN_97 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2S4A272 |
| Locus tag | E5R32_RS05440 | Protein ID | WP_001094443.1 |
| Coordinates | 1107189..1107566 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7LDN9 |
| Locus tag | E5R32_RS05435 | Protein ID | WP_001285607.1 |
| Coordinates | 1106731..1107099 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5R32_RS05400 (1102623) | 1102623..1103303 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| E5R32_RS05405 (1103451) | 1103451..1104128 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| E5R32_RS05410 (1104134) | 1104134..1104367 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| E5R32_RS05415 (1104457) | 1104457..1105275 | + | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| E5R32_RS05420 (1105367) | 1105367..1105852 | + | 486 | WP_000206664.1 | antirestriction protein | - |
| E5R32_RS05425 (1105867) | 1105867..1106343 | + | 477 | WP_001186165.1 | RadC family protein | - |
| E5R32_RS05430 (1106430) | 1106430..1106651 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| E5R32_RS05435 (1106731) | 1106731..1107099 | + | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E5R32_RS05440 (1107189) | 1107189..1107566 | + | 378 | WP_001094443.1 | TA system toxin CbtA family protein | Toxin |
| E5R32_RS05445 (1107563) | 1107563..1108051 | + | 489 | WP_000761685.1 | DUF5983 family protein | - |
| E5R32_RS05450 (1108071) | 1108071..1108268 | + | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| E5R32_RS05455 (1108353) | 1108353..1108496 | + | 144 | Protein_1070 | hypothetical protein | - |
| E5R32_RS05460 (1108912) | 1108912..1109838 | - | 927 | WP_000142493.1 | site-specific integrase | - |
| E5R32_RS05465 (1109828) | 1109828..1111447 | - | 1620 | WP_052907910.1 | MobH family relaxase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1095574..1143500 | 47926 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T265781 WP_001094443.1 NZ_CP113493:1107189-1107566 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT265781 WP_001285607.1 NZ_CP113493:1106731-1107099 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4A272 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0JLU8 |