Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 837055..837890 | Replicon | chromosome |
| Accession | NZ_CP113493 | ||
| Organism | Escherichia coli strain GTEN_97 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1C0Y405 |
| Locus tag | E5R32_RS03990 | Protein ID | WP_001774607.1 |
| Coordinates | 837055..837432 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M2U6P5 |
| Locus tag | E5R32_RS03995 | Protein ID | WP_001774606.1 |
| Coordinates | 837522..837890 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5R32_RS03965 (833128) | 833128..834111 | - | 984 | WP_001296394.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| E5R32_RS03970 (834921) | 834921..835091 | - | 171 | Protein_778 | IS110 family transposase | - |
| E5R32_RS03975 (835434) | 835434..836276 | - | 843 | WP_040235333.1 | DUF4942 domain-containing protein | - |
| E5R32_RS03980 (836361) | 836361..836558 | - | 198 | WP_032152719.1 | DUF957 domain-containing protein | - |
| E5R32_RS03985 (836570) | 836570..837058 | - | 489 | WP_001774608.1 | DUF5983 family protein | - |
| E5R32_RS03990 (837055) | 837055..837432 | - | 378 | WP_001774607.1 | TA system toxin CbtA family protein | Toxin |
| E5R32_RS03995 (837522) | 837522..837890 | - | 369 | WP_001774606.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| E5R32_RS04000 (837940) | 837940..838584 | - | 645 | WP_001774605.1 | hypothetical protein | - |
| E5R32_RS04005 (838603) | 838603..838824 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| E5R32_RS04010 (838893) | 838893..839369 | - | 477 | WP_001297237.1 | RadC family protein | - |
| E5R32_RS04015 (839385) | 839385..839870 | - | 486 | WP_040235172.1 | antirestriction protein | - |
| E5R32_RS04020 (839962) | 839962..840780 | - | 819 | WP_040235173.1 | DUF932 domain-containing protein | - |
| E5R32_RS04025 (840870) | 840870..841103 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 834921..835076 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14218.20 Da Isoelectric Point: 7.8045
>T265779 WP_001774607.1 NZ_CP113493:c837432-837055 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.31 Da Isoelectric Point: 5.8746
>AT265779 WP_001774606.1 NZ_CP113493:c837890-837522 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C0Y405 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2U6P5 |