Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 109064..109707 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP113487 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | FG550_RS25700 | Protein ID | WP_001034044.1 |
| Coordinates | 109291..109707 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | FG550_RS25695 | Protein ID | WP_001261286.1 |
| Coordinates | 109064..109294 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS25675 (105628) | 105628..106383 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| FG550_RS25680 (107105) | 107105..107911 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| FG550_RS25685 (107912) | 107912..108217 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| FG550_RS25690 (108219) | 108219..108437 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| FG550_RS25695 (109064) | 109064..109294 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| FG550_RS25700 (109291) | 109291..109707 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| FG550_RS25705 (109782) | 109782..111347 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| FG550_RS25710 (111332) | 111332..112354 | + | 1023 | WP_001563708.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | iutA / iucD / iucC / iucB / iucA | 1..123389 | 123389 | |
| - | flank | IS/Tn | - | - | 112608..112985 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T265774 WP_001034044.1 NZ_CP113487:109291-109707 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |