Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 107912..108437 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP113487 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | FG550_RS25685 | Protein ID | WP_001159871.1 |
| Coordinates | 107912..108217 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | FG550_RS25690 | Protein ID | WP_000813630.1 |
| Coordinates | 108219..108437 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS25670 (103874) | 103874..105040 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| FG550_RS25675 (105628) | 105628..106383 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| FG550_RS25680 (107105) | 107105..107911 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| FG550_RS25685 (107912) | 107912..108217 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| FG550_RS25690 (108219) | 108219..108437 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| FG550_RS25695 (109064) | 109064..109294 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| FG550_RS25700 (109291) | 109291..109707 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| FG550_RS25705 (109782) | 109782..111347 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| FG550_RS25710 (111332) | 111332..112354 | + | 1023 | WP_001563708.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | iutA / iucD / iucC / iucB / iucA | 1..123389 | 123389 | |
| - | flank | IS/Tn | - | - | 112608..112985 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T265773 WP_001159871.1 NZ_CP113487:c108217-107912 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |