Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 107912..108437 Replicon plasmid unnamed1
Accession NZ_CP113487
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag FG550_RS25685 Protein ID WP_001159871.1
Coordinates 107912..108217 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag FG550_RS25690 Protein ID WP_000813630.1
Coordinates 108219..108437 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS25670 (103874) 103874..105040 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
FG550_RS25675 (105628) 105628..106383 - 756 WP_000852146.1 replication initiation protein RepE -
FG550_RS25680 (107105) 107105..107911 - 807 WP_000016970.1 site-specific integrase -
FG550_RS25685 (107912) 107912..108217 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
FG550_RS25690 (108219) 108219..108437 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
FG550_RS25695 (109064) 109064..109294 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
FG550_RS25700 (109291) 109291..109707 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
FG550_RS25705 (109782) 109782..111347 + 1566 WP_001128474.1 AAA family ATPase -
FG550_RS25710 (111332) 111332..112354 + 1023 WP_001563708.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B iutA / iucD / iucC / iucB / iucA 1..123389 123389
- flank IS/Tn - - 112608..112985 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T265773 WP_001159871.1 NZ_CP113487:c108217-107912 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT265773 WP_000813630.1 NZ_CP113487:c108437-108219 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References