Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 56370..56995 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP113487 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | FG550_RS25340 | Protein ID | WP_000911333.1 |
| Coordinates | 56597..56995 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | FG550_RS25335 | Protein ID | WP_000450520.1 |
| Coordinates | 56370..56597 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS25335 (56370) | 56370..56597 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| FG550_RS25340 (56597) | 56597..56995 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| FG550_RS25345 (57004) | 57004..58008 | - | 1005 | Protein_69 | type IV secretion system DNA-binding domain-containing protein | - |
| FG550_RS25350 (58116) | 58116..58952 | - | 837 | WP_000480972.1 | aminoglycoside O-phosphotransferase APH(6)-Id | - |
| FG550_RS25355 (58952) | 58952..59755 | - | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| FG550_RS25360 (59816) | 59816..60631 | - | 816 | WP_001043260.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| FG550_RS25365 (60965) | 60965..61168 | + | 204 | WP_000131876.1 | hypothetical protein | - |
| FG550_RS25370 (61159) | 61159..61380 | + | 222 | WP_001251694.1 | hypothetical protein | - |
| FG550_RS25375 (61615) | 61615..61974 | - | 360 | WP_000050069.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | iutA / iucD / iucC / iucB / iucA | 1..123389 | 123389 | |
| - | flank | IS/Tn | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | - | 58116..63986 | 5870 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T265769 WP_000911333.1 NZ_CP113487:56597-56995 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|