Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 4590598..4591303 | Replicon | chromosome |
| Accession | NZ_CP113486 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | FG550_RS21985 | Protein ID | WP_000539521.1 |
| Coordinates | 4590917..4591303 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | FG550_RS21980 | Protein ID | WP_001280945.1 |
| Coordinates | 4590598..4590927 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS21965 (4585755) | 4585755..4586666 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
| FG550_RS21970 (4586844) | 4586844..4589192 | + | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
| FG550_RS21975 (4589200) | 4589200..4590528 | + | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
| FG550_RS21980 (4590598) | 4590598..4590927 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| FG550_RS21985 (4590917) | 4590917..4591303 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FG550_RS21990 (4591529) | 4591529..4592854 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| FG550_RS21995 (4593067) | 4593067..4593450 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| FG550_RS22000 (4593561) | 4593561..4594676 | + | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| FG550_RS22005 (4594673) | 4594673..4595299 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T265763 WP_000539521.1 NZ_CP113486:c4591303-4590917 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|