Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4137723..4138341 | Replicon | chromosome |
Accession | NZ_CP113486 | ||
Organism | Escherichia coli strain GTEN_23 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | FG550_RS19865 | Protein ID | WP_001291435.1 |
Coordinates | 4137723..4137941 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | FG550_RS19870 | Protein ID | WP_000344800.1 |
Coordinates | 4137967..4138341 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FG550_RS19830 (4133012) | 4133012..4133584 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
FG550_RS19835 (4133615) | 4133615..4133926 | - | 312 | WP_000409911.1 | MGMT family protein | - |
FG550_RS19845 (4134305) | 4134305..4134658 | + | 354 | WP_001550741.1 | DUF1428 family protein | - |
FG550_RS19850 (4134700) | 4134700..4136250 | - | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
FG550_RS19855 (4136414) | 4136414..4136884 | - | 471 | WP_000136192.1 | YlaC family protein | - |
FG550_RS19860 (4137000) | 4137000..4137551 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
FG550_RS19865 (4137723) | 4137723..4137941 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
FG550_RS19870 (4137967) | 4137967..4138341 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
FG550_RS19875 (4138887) | 4138887..4142036 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
FG550_RS19880 (4142059) | 4142059..4143252 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T265762 WP_001291435.1 NZ_CP113486:c4137941-4137723 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT265762 WP_000344800.1 NZ_CP113486:c4138341-4137967 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |