Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3507520..3508355 Replicon chromosome
Accession NZ_CP113486
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag FG550_RS16875 Protein ID WP_077513881.1
Coordinates 3507978..3508355 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A403D757
Locus tag FG550_RS16870 Protein ID WP_016230789.1
Coordinates 3507520..3507888 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS16840 (3503520) 3503520..3503993 + 474 WP_001350782.1 antirestriction protein -
FG550_RS16845 (3504009) 3504009..3504161 + 153 Protein_3285 hypothetical protein -
FG550_RS16850 (3504248) 3504248..3504994 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
FG550_RS16855 (3505009) 3505009..3506550 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
FG550_RS16860 (3506742) 3506742..3507071 + 330 Protein_3288 DNA repair protein RadC -
FG550_RS16865 (3507136) 3507136..3507357 + 222 WP_000692345.1 DUF987 domain-containing protein -
FG550_RS16870 (3507520) 3507520..3507888 + 369 WP_016230789.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
FG550_RS16875 (3507978) 3507978..3508355 + 378 WP_077513881.1 TA system toxin CbtA family protein Toxin
FG550_RS16880 (3508352) 3508352..3508840 + 489 WP_000761690.1 DUF5983 family protein -
FG550_RS16885 (3508857) 3508857..3509033 + 177 WP_000839286.1 DUF957 domain-containing protein -
FG550_RS16890 (3509139) 3509139..3509288 + 150 Protein_3294 hypothetical protein -
FG550_RS16895 (3509655) 3509655..3509831 + 177 Protein_3295 helix-turn-helix domain-containing protein -
FG550_RS16900 (3510095) 3510095..3510322 + 228 WP_024183600.1 hypothetical protein -
FG550_RS16905 (3510555) 3510555..3512177 + 1623 WP_241468718.1 Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14086.22 Da        Isoelectric Point: 7.7532

>T265758 WP_077513881.1 NZ_CP113486:3507978-3508355 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13614.45 Da        Isoelectric Point: 7.0264

>AT265758 WP_016230789.1 NZ_CP113486:3507520-3507888 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A403D757

References