Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3390064..3390586 | Replicon | chromosome |
| Accession | NZ_CP113486 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A829L6G8 |
| Locus tag | FG550_RS16265 | Protein ID | WP_001105433.1 |
| Coordinates | 3390296..3390586 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0SC69 |
| Locus tag | FG550_RS16260 | Protein ID | WP_000212715.1 |
| Coordinates | 3390064..3390306 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS16240 (3385783) | 3385783..3387156 | + | 1374 | WP_001522402.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
| FG550_RS16245 (3387306) | 3387306..3387857 | - | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
| FG550_RS16250 (3387951) | 3387951..3389303 | + | 1353 | WP_001162173.1 | metalloprotease PmbA | - |
| FG550_RS16255 (3389486) | 3389486..3389872 | + | 387 | WP_001232246.1 | cytochrome b562 | - |
| FG550_RS16260 (3390064) | 3390064..3390306 | + | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FG550_RS16265 (3390296) | 3390296..3390586 | + | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FG550_RS16270 (3390587) | 3390587..3391051 | - | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| FG550_RS16275 (3391231) | 3391231..3393369 | - | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| FG550_RS16280 (3393763) | 3393763..3395418 | - | 1656 | WP_001550509.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T265757 WP_001105433.1 NZ_CP113486:3390296-3390586 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829L6G8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H4B3 |