Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3378329..3378924 | Replicon | chromosome |
Accession | NZ_CP113486 | ||
Organism | Escherichia coli strain GTEN_23 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
Locus tag | FG550_RS16205 | Protein ID | WP_019842229.1 |
Coordinates | 3378574..3378924 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | FG550_RS16200 | Protein ID | WP_001223213.1 |
Coordinates | 3378329..3378580 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FG550_RS16190 (3373994) | 3373994..3377773 | + | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
FG550_RS16195 (3377776) | 3377776..3378117 | + | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
FG550_RS16200 (3378329) | 3378329..3378580 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
FG550_RS16205 (3378574) | 3378574..3378924 | + | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
FG550_RS16210 (3379128) | 3379128..3379658 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
FG550_RS16215 (3379968) | 3379968..3380924 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
FG550_RS16220 (3381056) | 3381056..3382558 | + | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
FG550_RS16225 (3382572) | 3382572..3383594 | + | 1023 | WP_001550507.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T265756 WP_019842229.1 NZ_CP113486:3378574-3378924 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NWK6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |