Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2621926..2622538 | Replicon | chromosome |
Accession | NZ_CP113486 | ||
Organism | Escherichia coli strain GTEN_23 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | FG550_RS12735 | Protein ID | WP_000833473.1 |
Coordinates | 2622353..2622538 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | FG550_RS12730 | Protein ID | WP_000499744.1 |
Coordinates | 2621926..2622336 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FG550_RS12715 (2617438) | 2617438..2618253 | - | 816 | WP_000891823.1 | AraC family transcriptional regulator | - |
FG550_RS12720 (2618479) | 2618479..2619879 | + | 1401 | WP_268101361.1 | MFS transporter | - |
FG550_RS12725 (2619890) | 2619890..2621854 | + | 1965 | WP_001551835.1 | glycoside hydrolase family 127 protein | - |
FG550_RS12730 (2621926) | 2621926..2622336 | - | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
FG550_RS12735 (2622353) | 2622353..2622538 | - | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
FG550_RS12740 (2622807) | 2622807..2624345 | - | 1539 | WP_001551836.1 | aldehyde dehydrogenase AldB | - |
FG550_RS12745 (2624546) | 2624546..2625697 | - | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T265753 WP_000833473.1 NZ_CP113486:c2622538-2622353 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT265753 WP_000499744.1 NZ_CP113486:c2622336-2621926 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|