Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 720030..720861 Replicon chromosome
Accession NZ_CP113486
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6C9I6Z5
Locus tag FG550_RS03435 Protein ID WP_001563930.1
Coordinates 720487..720861 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag FG550_RS03430 Protein ID WP_001285585.1
Coordinates 720030..720398 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS03400 (716919) 716919..717374 + 456 WP_000581504.1 IrmA family protein -
FG550_RS03405 (717453) 717453..717686 + 234 WP_001119729.1 DUF905 family protein -
FG550_RS03410 (717786) 717786..718604 + 819 WP_023910202.1 DUF932 domain-containing protein -
FG550_RS03415 (718695) 718695..719180 + 486 WP_000214393.1 antirestriction protein -
FG550_RS03420 (719196) 719196..719672 + 477 WP_023910200.1 RadC family protein -
FG550_RS03425 (719735) 719735..719956 + 222 WP_000692323.1 DUF987 domain-containing protein -
FG550_RS03430 (720030) 720030..720398 + 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
FG550_RS03435 (720487) 720487..720861 + 375 WP_001563930.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
FG550_RS03440 (720858) 720858..721052 + 195 WP_000988600.1 DUF5983 family protein -
FG550_RS03445 (721098) 721098..721178 + 81 Protein_677 hypothetical protein -
FG550_RS03450 (721467) 721467..721595 - 129 Protein_678 transposase domain-containing protein -
FG550_RS03455 (721715) 721715..721849 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
FG550_RS03460 (721950) 721950..722279 - 330 WP_000450409.1 DUF496 family protein -
FG550_RS03465 (722451) 722451..723509 - 1059 WP_001200891.1 FUSC family protein -
FG550_RS03470 (723707) 723707..724180 - 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
FG550_RS03475 (724299) 724299..725465 - 1167 WP_001563931.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13883.97 Da        Isoelectric Point: 7.8522

>T265745 WP_001563930.1 NZ_CP113486:720487-720861 [Escherichia coli]
MKTLPVLPGLAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT265745 WP_001285585.1 NZ_CP113486:720030-720398 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C9I6Z5

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References