Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 720030..720861 | Replicon | chromosome |
| Accession | NZ_CP113486 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6C9I6Z5 |
| Locus tag | FG550_RS03435 | Protein ID | WP_001563930.1 |
| Coordinates | 720487..720861 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | FG550_RS03430 | Protein ID | WP_001285585.1 |
| Coordinates | 720030..720398 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS03400 (716919) | 716919..717374 | + | 456 | WP_000581504.1 | IrmA family protein | - |
| FG550_RS03405 (717453) | 717453..717686 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| FG550_RS03410 (717786) | 717786..718604 | + | 819 | WP_023910202.1 | DUF932 domain-containing protein | - |
| FG550_RS03415 (718695) | 718695..719180 | + | 486 | WP_000214393.1 | antirestriction protein | - |
| FG550_RS03420 (719196) | 719196..719672 | + | 477 | WP_023910200.1 | RadC family protein | - |
| FG550_RS03425 (719735) | 719735..719956 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| FG550_RS03430 (720030) | 720030..720398 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| FG550_RS03435 (720487) | 720487..720861 | + | 375 | WP_001563930.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| FG550_RS03440 (720858) | 720858..721052 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| FG550_RS03445 (721098) | 721098..721178 | + | 81 | Protein_677 | hypothetical protein | - |
| FG550_RS03450 (721467) | 721467..721595 | - | 129 | Protein_678 | transposase domain-containing protein | - |
| FG550_RS03455 (721715) | 721715..721849 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| FG550_RS03460 (721950) | 721950..722279 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| FG550_RS03465 (722451) | 722451..723509 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| FG550_RS03470 (723707) | 723707..724180 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| FG550_RS03475 (724299) | 724299..725465 | - | 1167 | WP_001563931.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13883.97 Da Isoelectric Point: 7.8522
>T265745 WP_001563930.1 NZ_CP113486:720487-720861 [Escherichia coli]
MKTLPVLPGLAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGLAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C9I6Z5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |