Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 107640..108278 | Replicon | chromosome |
Accession | NZ_CP113486 | ||
Organism | Escherichia coli strain GTEN_23 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | FG550_RS00500 | Protein ID | WP_000813795.1 |
Coordinates | 107640..107816 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | FG550_RS00505 | Protein ID | WP_076797675.1 |
Coordinates | 107862..108278 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FG550_RS00480 (103262) | 103262..104473 | - | 1212 | WP_071591517.1 | BenE family transporter YdcO | - |
FG550_RS00485 (104526) | 104526..105062 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
FG550_RS00490 (105135) | 105135..107096 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
FG550_RS00495 (107188) | 107188..107418 | - | 231 | WP_023910283.1 | YncJ family protein | - |
FG550_RS00500 (107640) | 107640..107816 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
FG550_RS00505 (107862) | 107862..108278 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
FG550_RS00510 (108357) | 108357..109763 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
FG550_RS00515 (110008) | 110008..111153 | + | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
FG550_RS00520 (111171) | 111171..112184 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
FG550_RS00525 (112185) | 112185..113126 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T265739 WP_000813795.1 NZ_CP113486:107640-107816 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT265739 WP_076797675.1 NZ_CP113486:107862-108278 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|