Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 3398683..3399336 | Replicon | chromosome |
| Accession | NZ_CP113485 | ||
| Organism | Mycobacterium avium subsp. paratuberculosis strain LN20 | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | OUZ54_RS15880 | Protein ID | WP_003872880.1 |
| Coordinates | 3398683..3399144 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | Q742J1 |
| Locus tag | OUZ54_RS15885 | Protein ID | WP_003872881.1 |
| Coordinates | 3399148..3399336 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUZ54_RS15855 (OUZ54_15855) | 3394048..3394386 | - | 339 | WP_016705559.1 | hypothetical protein | - |
| OUZ54_RS15860 (OUZ54_15860) | 3394922..3395140 | + | 219 | WP_016705560.1 | hypothetical protein | - |
| OUZ54_RS15865 (OUZ54_15865) | 3395175..3395561 | - | 387 | WP_003872877.1 | hypothetical protein | - |
| OUZ54_RS15870 (OUZ54_15870) | 3395601..3397184 | - | 1584 | WP_170936827.1 | DUF4185 domain-containing protein | - |
| OUZ54_RS15875 (OUZ54_15875) | 3398180..3398614 | - | 435 | WP_003872879.1 | hypothetical protein | - |
| OUZ54_RS15880 (OUZ54_15880) | 3398683..3399144 | - | 462 | WP_003872880.1 | SRPBCC family protein | Toxin |
| OUZ54_RS15885 (OUZ54_15885) | 3399148..3399336 | - | 189 | WP_003872881.1 | antitoxin | Antitoxin |
| OUZ54_RS15890 (OUZ54_15890) | 3399399..3401771 | - | 2373 | WP_003872882.1 | HAD-IC family P-type ATPase | - |
| OUZ54_RS15895 (OUZ54_15895) | 3401768..3403354 | - | 1587 | WP_094028703.1 | serine hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16626.19 Da Isoelectric Point: 9.5654
>T265737 WP_003872880.1 NZ_CP113485:c3399144-3398683 [Mycobacterium avium subsp. paratuberculosis]
VAKLSGSIDVPLPPEVAWQHASDLSRYKEWLTIHRVWRSTLPDQIDKGTVVESIVEVKGMLNRIKWTVVRYKPPEGMTLN
GDGVGGVKVKLMAKVQPKADGSVVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFARSDPSTNGHR
VAKLSGSIDVPLPPEVAWQHASDLSRYKEWLTIHRVWRSTLPDQIDKGTVVESIVEVKGMLNRIKWTVVRYKPPEGMTLN
GDGVGGVKVKLMAKVQPKADGSVVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFARSDPSTNGHR
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|