Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1213247..1213811 Replicon chromosome
Accession NZ_CP113485
Organism Mycobacterium avium subsp. paratuberculosis strain LN20

Toxin (Protein)


Gene name vapC Uniprot ID X7VBD8
Locus tag OUZ54_RS06085 Protein ID WP_003875391.1
Coordinates 1213440..1213811 (+) Length 124 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A7L5MGM2
Locus tag OUZ54_RS06080 Protein ID WP_003875390.1
Coordinates 1213247..1213453 (+) Length 69 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OUZ54_RS06060 (OUZ54_06060) 1208500..1209498 + 999 WP_003875386.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
OUZ54_RS06065 (OUZ54_06065) 1209522..1210730 - 1209 WP_010949696.1 hypothetical protein -
OUZ54_RS06070 (OUZ54_06070) 1210861..1211934 + 1074 WP_009975391.1 redox-regulated ATPase YchF -
OUZ54_RS06075 (OUZ54_06075) 1212134..1213078 + 945 WP_003875389.1 HNH endonuclease signature motif containing protein -
OUZ54_RS06080 (OUZ54_06080) 1213247..1213453 + 207 WP_003875390.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OUZ54_RS06085 (OUZ54_06085) 1213440..1213811 + 372 WP_003875391.1 type II toxin-antitoxin system VapC family toxin Toxin
OUZ54_RS06090 (OUZ54_06090) 1213902..1214351 + 450 WP_024637459.1 nitroreductase family deazaflavin-dependent oxidoreductase -
OUZ54_RS06095 (OUZ54_06095) 1214407..1214682 + 276 WP_003878531.1 hypothetical protein -
OUZ54_RS06100 (OUZ54_06100) 1214784..1215182 + 399 WP_003875394.1 VOC family protein -
OUZ54_RS06105 (OUZ54_06105) 1215249..1215632 + 384 WP_003875395.1 hypothetical protein -
OUZ54_RS06110 (OUZ54_06110) 1215702..1216034 + 333 WP_094028823.1 hypothetical protein -
OUZ54_RS06115 (OUZ54_06115) 1216191..1216720 + 530 Protein_1206 peptidoglycan endopeptidase -
OUZ54_RS06120 (OUZ54_06120) 1217133..1217457 + 325 Protein_1207 putative quinol monooxygenase -
OUZ54_RS06125 (OUZ54_06125) 1217462..1218145 - 684 WP_003875399.1 hypothetical protein -
OUZ54_RS06130 (OUZ54_06130) 1218263..1218460 + 198 WP_016706054.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13770.14 Da        Isoelectric Point: 6.6003

>T265734 WP_003875391.1 NZ_CP113485:1213440-1213811 [Mycobacterium avium subsp. paratuberculosis]
MILVDTSVWIDHLHVADKRLIEFLTNDAIGCHQMVIEELALGAIRRRADLLRLLSNLRAFPLLTHAEVLHLVECHRLWGR
GLSAIDVHLLGSVALVDGARLWTRDKNLKAAGWDVGIAIVDEL

Download         Length: 372 bp

Antitoxin


Download         Length: 69 a.a.        Molecular weight: 7231.22 Da        Isoelectric Point: 11.0634

>AT265734 WP_003875390.1 NZ_CP113485:1213247-1213453 [Mycobacterium avium subsp. paratuberculosis]
MRTTVTIDDALLAEAAELTGVTESVALLRQGLQTLVRVESARRLAALGGTDRKASVGPRRRAPADDSR

Download         Length: 207 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2WB37

Antitoxin

Source ID Structure
AlphaFold DB A0A7L5MGM2

References