Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4940..5562 | Replicon | plasmid pC9_4 |
| Accession | NZ_CP113446 | ||
| Organism | Acinetobacter baumannii strain C9 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OQH41_RS19105 | Protein ID | WP_049173621.1 |
| Coordinates | 4940..5335 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3D2SL40 |
| Locus tag | OQH41_RS19110 | Protein ID | WP_049173623.1 |
| Coordinates | 5332..5562 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQH41_RS19080 (OQH41_19080) | 1..936 | + | 936 | WP_049173632.1 | replication initiation protein RepM | - |
| OQH41_RS19085 (OQH41_19085) | 1005..1550 | + | 546 | WP_171249447.1 | plasmid replication DNA-binding protein | - |
| OQH41_RS19090 (OQH41_19090) | 1984..2484 | + | 501 | WP_049173636.1 | hypothetical protein | - |
| OQH41_RS19095 (OQH41_19095) | 2477..3025 | + | 549 | WP_049173638.1 | DUF4062 domain-containing protein | - |
| OQH41_RS19100 (OQH41_19100) | 3029..4351 | + | 1323 | WP_049173641.1 | hypothetical protein | - |
| OQH41_RS19105 (OQH41_19105) | 4940..5335 | - | 396 | WP_049173621.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OQH41_RS19110 (OQH41_19110) | 5332..5562 | - | 231 | WP_049173623.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OQH41_RS19115 (OQH41_19115) | 6171..6620 | + | 450 | WP_049173625.1 | hypothetical protein | - |
| OQH41_RS19120 (OQH41_19120) | 7326..7529 | - | 204 | WP_049173627.1 | hypothetical protein | - |
| OQH41_RS19125 (OQH41_19125) | 7556..7888 | - | 333 | WP_049173629.1 | type II toxin-antitoxin system YafQ family toxin | - |
| OQH41_RS19130 (OQH41_19130) | 7866..8141 | - | 276 | WP_049173631.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..8916 | 8916 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14893.16 Da Isoelectric Point: 6.2238
>T265733 WP_049173621.1 NZ_CP113446:c5335-4940 [Acinetobacter baumannii]
MIYLLDTNICIYVINNKPQHVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLEILPYDDQAIWHYA
KLRQDLQSTGKPIGSLDMLIAAHALALDVVLVTNNTKEFERIDGLKLENWV
MIYLLDTNICIYVINNKPQHVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLEILPYDDQAIWHYA
KLRQDLQSTGKPIGSLDMLIAAHALALDVVLVTNNTKEFERIDGLKLENWV
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|