Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 8038..8622 Replicon plasmid pC9_2
Accession NZ_CP113444
Organism Acinetobacter baumannii strain C9

Toxin (Protein)


Gene name PumA Uniprot ID A0A7H2PX46
Locus tag OQH41_RS18945 Protein ID WP_049066985.1
Coordinates 8320..8622 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7H2PX47
Locus tag OQH41_RS18940 Protein ID WP_049066984.1
Coordinates 8038..8319 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQH41_RS18905 (OQH41_18905) 3431..3631 - 201 Protein_2 GABA permease -
OQH41_RS18910 (OQH41_18910) 3556..3984 - 429 WP_002124576.1 hypothetical protein -
OQH41_RS18915 (OQH41_18915) 4154..4324 - 171 WP_252151107.1 DUF2798 domain-containing protein -
OQH41_RS18920 (OQH41_18920) 4392..4724 - 333 WP_004282109.1 hypothetical protein -
OQH41_RS18925 (OQH41_18925) 4968..5579 + 612 WP_004740252.1 recombinase family protein -
OQH41_RS18930 (OQH41_18930) 6507..6968 - 462 WP_000761345.1 DIP1984 family protein -
OQH41_RS18935 (OQH41_18935) 7505..7840 - 336 WP_004740263.1 carboxymuconolactone decarboxylase family protein -
OQH41_RS18940 (OQH41_18940) 8038..8319 - 282 WP_049066984.1 putative addiction module antidote protein Antitoxin
OQH41_RS18945 (OQH41_18945) 8320..8622 - 303 WP_049066985.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OQH41_RS18950 (OQH41_18950) 8767..9195 + 429 WP_030423737.1 hypothetical protein -
OQH41_RS18955 (OQH41_18955) 9844..11274 + 1431 WP_086249647.1 N-6 DNA methylase -
OQH41_RS18960 (OQH41_18960) 11271..12215 + 945 WP_086249648.1 BsuBI/PstI family type II restriction endonuclease -
OQH41_RS18965 (OQH41_18965) 12290..12886 - 597 WP_086249649.1 hypothetical protein -
OQH41_RS18970 (OQH41_18970) 12909..13118 - 210 WP_086249650.1 hypothetical protein -
OQH41_RS18975 (OQH41_18975) 13191..13370 - 180 WP_016651005.1 hypothetical protein -
OQH41_RS18980 (OQH41_18980) 13384..13551 - 168 WP_171291933.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..17980 17980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11589.07 Da        Isoelectric Point: 4.6838

>T265732 WP_049066985.1 NZ_CP113444:c8622-8320 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLSGGDKS
TQSKDIKLALQLAQDLEEEL

Download         Length: 303 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10151.75 Da        Isoelectric Point: 8.0018

>AT265732 WP_049066984.1 NZ_CP113444:c8319-8038 [Acinetobacter baumannii]
MAIKLRKWDSAEHLKTEEDMQAYLQVCIEESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTV
IKVVKALNLRLAI

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H2PX46

Antitoxin

Source ID Structure
AlphaFold DB A0A7H2PX47

References