Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 759976..760654 | Replicon | chromosome |
| Accession | NZ_CP113442 | ||
| Organism | Acinetobacter baumannii strain C9 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OQH41_RS03595 | Protein ID | WP_000009390.1 |
| Coordinates | 760475..760654 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OQH41_RS03590 | Protein ID | WP_005112025.1 |
| Coordinates | 759976..760389 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQH41_RS03555 (OQH41_03555) | 755577..756797 | + | 1221 | WP_005129596.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
| OQH41_RS03560 (OQH41_03560) | 756944..758008 | + | 1065 | WP_001278262.1 | quinolinate synthase NadA | - |
| OQH41_RS03585 (OQH41_03585) | 759201..759719 | + | 519 | WP_031945607.1 | hypothetical protein | - |
| OQH41_RS03590 (OQH41_03590) | 759976..760389 | - | 414 | WP_005112025.1 | hypothetical protein | Antitoxin |
| OQH41_RS03595 (OQH41_03595) | 760475..760654 | - | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OQH41_RS03600 (OQH41_03600) | 760762..760977 | - | 216 | WP_227552920.1 | hypothetical protein | - |
| OQH41_RS03605 (OQH41_03605) | 760988..762034 | - | 1047 | WP_194299481.1 | phage portal protein | - |
| OQH41_RS03610 (OQH41_03610) | 762031..763809 | - | 1779 | WP_005112022.1 | terminase family protein | - |
| OQH41_RS03615 (OQH41_03615) | 763988..764839 | + | 852 | WP_005112021.1 | GPO family capsid scaffolding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 759976..795255 | 35279 | |
| - | inside | Prophage | - | - | 759976..799496 | 39520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6799.11 Da Isoelectric Point: 11.1422
>T265728 WP_000009390.1 NZ_CP113442:c760654-760475 [Acinetobacter baumannii]
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
Download Length: 180 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15362.75 Da Isoelectric Point: 6.2451
>AT265728 WP_005112025.1 NZ_CP113442:c760389-759976 [Acinetobacter baumannii]
MKCYVSIHREGEAFIVSSSELPELNSVGYTLEEALSEALDGIETVFEIYMDERKAIPLPSKGKKGEYVVHLPVRVAAKVR
LYNEMISQNVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFQALGKDLDIVIA
MKCYVSIHREGEAFIVSSSELPELNSVGYTLEEALSEALDGIETVFEIYMDERKAIPLPSKGKKGEYVVHLPVRVAAKVR
LYNEMISQNVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFQALGKDLDIVIA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|