Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 1610722..1611830 | Replicon | chromosome |
Accession | NZ_CP113440 | ||
Organism | Streptococcus macedonicus strain E37 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | OQG81_RS08500 | Protein ID | WP_000233000.1 |
Coordinates | 1610722..1611591 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | OQG81_RS08505 | Protein ID | WP_000205227.1 |
Coordinates | 1611606..1611830 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQG81_RS08470 (OQG81_08470) | 1605850..1605933 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
OQG81_RS08475 (OQG81_08475) | 1606475..1607269 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
OQG81_RS08485 (OQG81_08485) | 1608589..1609069 | - | 481 | Protein_1618 | GNAT family N-acetyltransferase | - |
OQG81_RS08490 (OQG81_08490) | 1609066..1609974 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
OQG81_RS08495 (OQG81_08495) | 1610007..1610741 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
OQG81_RS08500 (OQG81_08500) | 1610722..1611591 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
OQG81_RS08505 (OQG81_08505) | 1611606..1611830 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OQG81_RS08510 (OQG81_08510) | 1611973..1612059 | - | 87 | Protein_1623 | site-specific recombinase | - |
OQG81_RS08515 (OQG81_08515) | 1612199..1613455 | + | 1257 | WP_265631682.1 | ISL3 family transposase | - |
OQG81_RS08520 (OQG81_08520) | 1613498..1613689 | - | 192 | WP_024381035.1 | hypothetical protein | - |
OQG81_RS08525 (OQG81_08525) | 1613778..1614050 | - | 273 | WP_024381592.1 | DUF3884 family protein | - |
OQG81_RS08530 (OQG81_08530) | 1614079..1615395 | - | 1317 | WP_265644189.1 | glycosyltransferase family 2 protein | - |
OQG81_RS08535 (OQG81_08535) | 1615517..1615744 | - | 228 | WP_024381594.1 | hypothetical protein | - |
OQG81_RS08540 (OQG81_08540) | 1615987..1616580 | - | 594 | WP_024381595.1 | PBECR4 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | erm(B) / aph(3')-III / ant(6)-Ia | - | 1601795..1633401 | 31606 | |
- | inside | IScluster/Tn | erm(B) / aph(3')-III / ant(6)-Ia | - | 1603273..1618482 | 15209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T265727 WP_000233000.1 NZ_CP113440:c1611591-1610722 [Streptococcus macedonicus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|