Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3303402..3303939 | Replicon | chromosome |
Accession | NZ_CP113437 | ||
Organism | Legionella pneumophila strain PATHC007 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OXA90_RS14720 | Protein ID | WP_042234319.1 |
Coordinates | 3303402..3303698 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OXA90_RS14725 | Protein ID | WP_027266056.1 |
Coordinates | 3303688..3303939 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXA90_RS14695 (OXA90_14695) | 3299612..3300505 | - | 894 | WP_042234326.1 | hypothetical protein | - |
OXA90_RS14700 (OXA90_14700) | 3300773..3300964 | + | 192 | WP_011947807.1 | hypothetical protein | - |
OXA90_RS14705 (OXA90_14705) | 3301111..3301215 | - | 105 | Protein_2885 | lytic murein transglycosylase | - |
OXA90_RS14710 (OXA90_14710) | 3301309..3301638 | - | 330 | Protein_2886 | hypothetical protein | - |
OXA90_RS14715 (OXA90_14715) | 3302831..3303313 | - | 483 | WP_014842908.1 | hypothetical protein | - |
OXA90_RS14720 (OXA90_14720) | 3303402..3303698 | - | 297 | WP_042234319.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXA90_RS14725 (OXA90_14725) | 3303688..3303939 | - | 252 | WP_027266056.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OXA90_RS14730 (OXA90_14730) | 3304805..3305944 | - | 1140 | WP_129317146.1 | DUF3800 domain-containing protein | - |
OXA90_RS14735 (OXA90_14735) | 3306062..3306619 | - | 558 | WP_129317147.1 | recombinase family protein | - |
OXA90_RS14740 (OXA90_14740) | 3306707..3306847 | + | 141 | WP_154231193.1 | hypothetical protein | - |
OXA90_RS14745 (OXA90_14745) | 3306872..3307375 | - | 504 | WP_042234312.1 | hypothetical protein | - |
OXA90_RS14750 (OXA90_14750) | 3307485..3308531 | - | 1047 | WP_027219936.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11424.29 Da Isoelectric Point: 10.5027
>T265720 WP_042234319.1 NZ_CP113437:c3303698-3303402 [Legionella pneumophila]
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASAGLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYGDADNRQEDS
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASAGLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYGDADNRQEDS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|