Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2298810..2299326 | Replicon | chromosome |
Accession | NZ_CP113432 | ||
Organism | Pseudomonas sp. ZM23 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OU419_RS10835 | Protein ID | WP_254472157.1 |
Coordinates | 2298810..2299091 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OU419_RS10840 | Protein ID | WP_254472158.1 |
Coordinates | 2299081..2299326 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU419_RS10805 (OU419_10805) | 2294628..2294900 | + | 273 | WP_254472211.1 | hypothetical protein | - |
OU419_RS10810 (OU419_10810) | 2294993..2295961 | + | 969 | WP_254472153.1 | DUF932 domain-containing protein | - |
OU419_RS10815 (OU419_10815) | 2296041..2297045 | + | 1005 | WP_254472212.1 | YqaJ viral recombinase family protein | - |
OU419_RS10820 (OU419_10820) | 2297137..2298087 | + | 951 | WP_254472154.1 | hydrolase or metal-binding protein | - |
OU419_RS10825 (OU419_10825) | 2298059..2298556 | + | 498 | WP_254472155.1 | DNA repair protein RadC | - |
OU419_RS10830 (OU419_10830) | 2298567..2298740 | + | 174 | WP_254472156.1 | hypothetical protein | - |
OU419_RS10835 (OU419_10835) | 2298810..2299091 | - | 282 | WP_254472157.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OU419_RS10840 (OU419_10840) | 2299081..2299326 | - | 246 | WP_254472158.1 | antitoxin | Antitoxin |
OU419_RS10845 (OU419_10845) | 2299515..2300213 | - | 699 | WP_254472159.1 | inovirus Gp2 family protein | - |
OU419_RS10850 (OU419_10850) | 2300512..2301858 | - | 1347 | WP_254472160.1 | site-specific integrase | - |
OU419_RS10855 (OU419_10855) | 2302394..2303377 | - | 984 | WP_254472161.1 | nitronate monooxygenase | - |
OU419_RS10860 (OU419_10860) | 2303515..2304174 | - | 660 | WP_254472162.1 | amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2272999..2300213 | 27214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10772.61 Da Isoelectric Point: 10.6485
>T265710 WP_254472157.1 NZ_CP113432:c2299091-2298810 [Pseudomonas sp. ZM23]
MTYKLEFLPSALKEWEKLGHTVREQAKKKLGERLEAPKVQADALRDLPGHYKIKLRTASYRLVYRVEDDRVVVMVVAVSK
RERSTAYKAAGKR
MTYKLEFLPSALKEWEKLGHTVREQAKKKLGERLEAPKVQADALRDLPGHYKIKLRTASYRLVYRVEDDRVVVMVVAVSK
RERSTAYKAAGKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|