Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 1826865..1827462 | Replicon | chromosome |
Accession | NZ_CP113432 | ||
Organism | Pseudomonas sp. ZM23 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | OU419_RS08710 | Protein ID | WP_254476673.1 |
Coordinates | 1827121..1827462 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | OU419_RS08705 | Protein ID | WP_254476672.1 |
Coordinates | 1826865..1827113 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU419_RS08680 (OU419_08680) | 1821940..1822182 | + | 243 | WP_254476843.1 | major capsid protein | - |
OU419_RS08685 (OU419_08685) | 1822330..1823610 | + | 1281 | WP_268173309.1 | attachment protein | - |
OU419_RS08690 (OU419_08690) | 1823614..1823970 | + | 357 | WP_254476845.1 | DUF2523 family protein | - |
OU419_RS08695 (OU419_08695) | 1823974..1825263 | + | 1290 | WP_268173310.1 | zonular occludens toxin domain-containing protein | - |
OU419_RS08700 (OU419_08700) | 1825499..1826773 | + | 1275 | WP_254476671.1 | hypothetical protein | - |
OU419_RS08705 (OU419_08705) | 1826865..1827113 | + | 249 | WP_254476672.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OU419_RS08710 (OU419_08710) | 1827121..1827462 | + | 342 | WP_254476673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OU419_RS08715 (OU419_08715) | 1827855..1828259 | - | 405 | WP_254476674.1 | hypothetical protein | - |
OU419_RS08720 (OU419_08720) | 1828329..1828670 | - | 342 | WP_254476675.1 | carboxymuconolactone decarboxylase family protein | - |
OU419_RS08725 (OU419_08725) | 1828784..1829701 | + | 918 | WP_254476676.1 | AraC family transcriptional regulator | - |
OU419_RS08730 (OU419_08730) | 1829695..1830177 | - | 483 | WP_254476741.1 | GreA/GreB family elongation factor | - |
OU419_RS08735 (OU419_08735) | 1830326..1830694 | + | 369 | WP_254476677.1 | DUF2384 domain-containing protein | - |
OU419_RS08740 (OU419_08740) | 1830695..1831456 | + | 762 | WP_254476678.1 | RES family NAD+ phosphorylase | - |
OU419_RS08745 (OU419_08745) | 1831531..1831740 | + | 210 | WP_254476679.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12908.56 Da Isoelectric Point: 4.4676
>T265707 WP_254476673.1 NZ_CP113432:1827121-1827462 [Pseudomonas sp. ZM23]
MTILDVRFTETAVFSIQDQEEHLAEYHPAEVAAAKIDTLIDDILTRLQNAPVGYPVSRQASDLGVTRYRELNHDGYRVFY
EVYEHDNAIAVELVLRQKQDVEAALIRYCLVGI
MTILDVRFTETAVFSIQDQEEHLAEYHPAEVAAAKIDTLIDDILTRLQNAPVGYPVSRQASDLGVTRYRELNHDGYRVFY
EVYEHDNAIAVELVLRQKQDVEAALIRYCLVGI
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|