Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2341674..2342649 | Replicon | chromosome |
Accession | NZ_CP113428 | ||
Organism | Bacillus cereus strain NW6 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | C3GJ28 |
Locus tag | OU819_RS12060 | Protein ID | WP_003297560.1 |
Coordinates | 2341674..2342411 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | OU819_RS12065 | Protein ID | WP_000588712.1 |
Coordinates | 2342524..2342649 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU819_RS12030 (OU819_12030) | 2336749..2337459 | + | 711 | WP_000787475.1 | class I SAM-dependent methyltransferase | - |
OU819_RS12035 (OU819_12035) | 2337579..2337986 | + | 408 | WP_000072479.1 | VOC family protein | - |
OU819_RS12040 (OU819_12040) | 2338092..2338184 | + | 93 | Protein_2288 | methyltransferase | - |
OU819_RS12045 (OU819_12045) | 2338306..2339991 | - | 1686 | WP_267999198.1 | alpha-keto acid decarboxylase family protein | - |
OU819_RS12050 (OU819_12050) | 2340098..2340580 | + | 483 | WP_088016051.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OU819_RS12055 (OU819_12055) | 2340748..2341485 | + | 738 | WP_000594156.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
OU819_RS12060 (OU819_12060) | 2341674..2342411 | + | 738 | WP_003297560.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OU819_RS12065 (OU819_12065) | 2342524..2342649 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
OU819_RS12070 (OU819_12070) | 2342726..2342902 | + | 177 | WP_088016052.1 | stage II sporulation protein SB | - |
OU819_RS12075 (OU819_12075) | 2342946..2343221 | - | 276 | WP_088016053.1 | hypothetical protein | - |
OU819_RS12080 (OU819_12080) | 2343502..2343739 | - | 238 | Protein_2296 | hypothetical protein | - |
OU819_RS12085 (OU819_12085) | 2343876..2344001 | + | 126 | WP_000694311.1 | hypothetical protein | - |
OU819_RS12090 (OU819_12090) | 2344078..2344254 | + | 177 | WP_000808045.1 | stage II sporulation protein SB | - |
OU819_RS12095 (OU819_12095) | 2344398..2345867 | + | 1470 | WP_001983236.1 | beta-Ala-His dipeptidase | - |
OU819_RS12100 (OU819_12100) | 2346431..2346901 | - | 471 | WP_088016055.1 | DUF5065 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28373.07 Da Isoelectric Point: 8.2672
>T265705 WP_003297560.1 NZ_CP113428:2341674-2342411 [Bacillus cereus]
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R9EK80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |