Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4246753..4247534 | Replicon | chromosome |
Accession | NZ_CP113364 | ||
Organism | Salmonella enterica subsp. enterica strain KNP01 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | OU685_RS20735 | Protein ID | WP_000625911.1 |
Coordinates | 4246753..4247244 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | OU685_RS20740 | Protein ID | WP_001271379.1 |
Coordinates | 4247241..4247534 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU685_RS20710 (4241887) | 4241887..4244325 | - | 2439 | WP_017441226.1 | F4 (K88) fimbrial usher FaeD | - |
OU685_RS20715 (4244335) | 4244335..4244874 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
OU685_RS20720 (4244909) | 4244909..4245193 | - | 285 | WP_192917775.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
OU685_RS20725 (4245787) | 4245787..4246044 | + | 258 | WP_001112996.1 | hypothetical protein | - |
OU685_RS20730 (4246290) | 4246290..4246538 | - | 249 | Protein_4051 | IS481 family transposase | - |
OU685_RS20735 (4246753) | 4246753..4247244 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
OU685_RS20740 (4247241) | 4247241..4247534 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
OU685_RS20745 (4247852) | 4247852..4248073 | + | 222 | WP_001595143.1 | hypothetical protein | - |
OU685_RS20750 (4248339) | 4248339..4249214 | + | 876 | WP_017441228.1 | AraC family transcriptional regulator | - |
OU685_RS20755 (4249211) | 4249211..4249498 | + | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
OU685_RS20760 (4249505) | 4249505..4249672 | - | 168 | WP_071527476.1 | ATP-binding cassette domain-containing protein | - |
OU685_RS20765 (4249692) | 4249692..4249791 | + | 100 | Protein_4058 | hypothetical protein | - |
OU685_RS20770 (4249839) | 4249839..4250033 | + | 195 | WP_223195369.1 | hypothetical protein | - |
OU685_RS20775 (4250327) | 4250327..4251232 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4235143..4249498 | 14355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T265699 WP_000625911.1 NZ_CP113364:c4247244-4246753 [Salmonella enterica subsp. enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |