Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 4102074..4102717 | Replicon | chromosome |
| Accession | NZ_CP113364 | ||
| Organism | Salmonella enterica subsp. enterica strain KNP01 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OU685_RS19995 | Protein ID | WP_017441191.1 |
| Coordinates | 4102301..4102717 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | OU685_RS19990 | Protein ID | WP_001261294.1 |
| Coordinates | 4102074..4102304 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU685_RS19980 (4099088) | 4099088..4101226 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OU685_RS19985 (4101443) | 4101443..4101907 | + | 465 | WP_017441190.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OU685_RS19990 (4102074) | 4102074..4102304 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OU685_RS19995 (4102301) | 4102301..4102717 | + | 417 | WP_017441191.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OU685_RS20000 (4102778) | 4102778..4104691 | - | 1914 | WP_023242878.1 | BglG family transcription antiterminator | - |
| OU685_RS20005 (4104708) | 4104708..4105448 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
| OU685_RS20010 (4105445) | 4105445..4106563 | - | 1119 | WP_001139194.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| OU685_RS20015 (4106547) | 4106547..4107680 | - | 1134 | WP_017441192.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15163.55 Da Isoelectric Point: 8.1381
>T265698 WP_017441191.1 NZ_CP113364:4102301-4102717 [Salmonella enterica subsp. enterica]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|