Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4060503..4061053 Replicon chromosome
Accession NZ_CP113364
Organism Salmonella enterica subsp. enterica strain KNP01

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag OU685_RS19780 Protein ID WP_001199743.1
Coordinates 4060503..4060811 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag OU685_RS19785 Protein ID WP_000016244.1
Coordinates 4060814..4061053 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OU685_RS19760 (4055838) 4055838..4056749 + 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -
OU685_RS19765 (4056855) 4056855..4057310 + 456 WP_031615695.1 NUDIX domain-containing protein -
OU685_RS19770 (4057601) 4057601..4059220 + 1620 WP_017441177.1 MobH family relaxase -
OU685_RS19775 (4059210) 4059210..4060136 + 927 WP_017441178.1 site-specific integrase -
OU685_RS19780 (4060503) 4060503..4060811 - 309 WP_001199743.1 CcdB family protein Toxin
OU685_RS19785 (4060814) 4060814..4061053 - 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OU685_RS19790 (4061162) 4061162..4061386 - 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
OU685_RS19795 (4061487) 4061487..4061795 - 309 Protein_3869 DUF4942 domain-containing protein -
OU685_RS19800 (4061815) 4061815..4062792 - 978 WP_223195356.1 IS630 family transposase -
OU685_RS19810 (4063550) 4063550..4064569 + 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
OU685_RS19815 (4064597) 4064597..4065127 - 531 WP_017441181.1 gluconokinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4046313..4062747 16434
- flank IS/Tn - - 4061815..4062747 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T265697 WP_001199743.1 NZ_CP113364:c4060811-4060503 [Salmonella enterica subsp. enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT265697 WP_000016244.1 NZ_CP113364:c4061053-4060814 [Salmonella enterica subsp. enterica]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References