Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3399359..3399979 | Replicon | chromosome |
Accession | NZ_CP113364 | ||
Organism | Salmonella enterica subsp. enterica strain KNP01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OU685_RS16715 | Protein ID | WP_001280991.1 |
Coordinates | 3399761..3399979 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OU685_RS16710 | Protein ID | WP_000344807.1 |
Coordinates | 3399359..3399733 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU685_RS16700 (3394498) | 3394498..3395691 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OU685_RS16705 (3395714) | 3395714..3398863 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OU685_RS16710 (3399359) | 3399359..3399733 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OU685_RS16715 (3399761) | 3399761..3399979 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OU685_RS16720 (3400158) | 3400158..3400709 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
OU685_RS16725 (3400825) | 3400825..3401295 | + | 471 | WP_000136183.1 | YlaC family protein | - |
OU685_RS16730 (3401351) | 3401351..3401491 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OU685_RS16735 (3401497) | 3401497..3401757 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OU685_RS16740 (3401982) | 3401982..3403532 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
OU685_RS16750 (3403763) | 3403763..3404152 | + | 390 | WP_000961285.1 | MGMT family protein | - |
OU685_RS16755 (3404185) | 3404185..3404754 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265690 WP_001280991.1 NZ_CP113364:3399761-3399979 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265690 WP_000344807.1 NZ_CP113364:3399359-3399733 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|