Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2366456..2366978 | Replicon | chromosome |
| Accession | NZ_CP113364 | ||
| Organism | Salmonella enterica subsp. enterica strain KNP01 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | OU685_RS11605 | Protein ID | WP_000221345.1 |
| Coordinates | 2366694..2366978 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | OU685_RS11600 | Protein ID | WP_000885424.1 |
| Coordinates | 2366456..2366704 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU685_RS11570 (2361999) | 2361999..2362779 | + | 781 | Protein_2259 | helix-turn-helix domain-containing protein | - |
| OU685_RS11575 (2362781) | 2362781..2363689 | - | 909 | WP_077906523.1 | hypothetical protein | - |
| OU685_RS11580 (2363962) | 2363962..2364294 | - | 333 | WP_017441352.1 | DUF1493 family protein | - |
| OU685_RS11585 (2364817) | 2364817..2364933 | - | 117 | Protein_2262 | IS110 family transposase | - |
| OU685_RS11590 (2365298) | 2365298..2365687 | + | 390 | WP_017441353.1 | hypothetical protein | - |
| OU685_RS11595 (2365690) | 2365690..2366043 | + | 354 | WP_000418733.1 | hypothetical protein | - |
| OU685_RS11600 (2366456) | 2366456..2366704 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OU685_RS11605 (2366694) | 2366694..2366978 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OU685_RS11610 (2367149) | 2367149..2367538 | + | 390 | WP_001652798.1 | RidA family protein | - |
| OU685_RS11615 (2367596) | 2367596..2368669 | - | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| OU685_RS11620 (2368862) | 2368862..2369350 | - | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OU685_RS11625 (2369395) | 2369395..2370903 | + | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2357250..2373760 | 16510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T265689 WP_000221345.1 NZ_CP113364:2366694-2366978 [Salmonella enterica subsp. enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |