Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 967633..968447 | Replicon | chromosome |
| Accession | NZ_CP113364 | ||
| Organism | Salmonella enterica subsp. enterica strain KNP01 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | A0A3W0Q3Z8 |
| Locus tag | OU685_RS04645 | Protein ID | WP_017441137.1 |
| Coordinates | 967633..968160 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | A0A418Z520 |
| Locus tag | OU685_RS04650 | Protein ID | WP_017441138.1 |
| Coordinates | 968157..968447 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU685_RS04615 (964006) | 964006..964404 | + | 399 | Protein_902 | cytoplasmic protein | - |
| OU685_RS04620 (964595) | 964595..964834 | + | 240 | Protein_903 | hypothetical protein | - |
| OU685_RS04625 (964991) | 964991..965659 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| OU685_RS04630 (965686) | 965686..966180 | + | 495 | WP_000424947.1 | hypothetical protein | - |
| OU685_RS04635 (966351) | 966351..967007 | - | 657 | WP_017441135.1 | protein-serine/threonine phosphatase | - |
| OU685_RS04640 (967345) | 967345..967560 | + | 216 | Protein_907 | IS5/IS1182 family transposase | - |
| OU685_RS04645 (967633) | 967633..968160 | - | 528 | WP_017441137.1 | GNAT family N-acetyltransferase | Toxin |
| OU685_RS04650 (968157) | 968157..968447 | - | 291 | WP_017441138.1 | DUF1778 domain-containing protein | Antitoxin |
| OU685_RS04655 (968717) | 968717..968917 | - | 201 | Protein_910 | IS3 family transposase | - |
| OU685_RS04660 (969158) | 969158..969484 | + | 327 | WP_000393295.1 | hypothetical protein | - |
| OU685_RS04665 (969757) | 969757..970104 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
| OU685_RS04670 (970089) | 970089..970538 | - | 450 | WP_017441139.1 | hypothetical protein | - |
| OU685_RS04675 (970970) | 970970..971413 | - | 444 | WP_017441140.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| OU685_RS04680 (971869) | 971869..972519 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 967420..977832 | 10412 | |
| - | flank | IS/Tn | - | - | 967420..967560 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19035.89 Da Isoelectric Point: 9.6420
>T265683 WP_017441137.1 NZ_CP113364:c968160-967633 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3W0Q3Z8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A418Z520 |