Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 809433..810093 | Replicon | chromosome |
Accession | NZ_CP113364 | ||
Organism | Salmonella enterica subsp. enterica strain KNP01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3V4SJP5 |
Locus tag | OU685_RS03925 | Protein ID | WP_000244755.1 |
Coordinates | 809680..810093 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | OU685_RS03920 | Protein ID | WP_000351186.1 |
Coordinates | 809433..809699 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU685_RS03900 (805362) | 805362..806795 | - | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
OU685_RS03905 (806953) | 806953..807264 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
OU685_RS03910 (807428) | 807428..808087 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
OU685_RS03915 (808203) | 808203..809183 | - | 981 | WP_017441090.1 | tRNA-modifying protein YgfZ | - |
OU685_RS03920 (809433) | 809433..809699 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
OU685_RS03925 (809680) | 809680..810093 | + | 414 | WP_000244755.1 | protein YgfX | Toxin |
OU685_RS03930 (810146) | 810146..810667 | - | 522 | WP_017441091.1 | flavodoxin FldB | - |
OU685_RS03935 (810780) | 810780..811676 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
OU685_RS03940 (811700) | 811700..812413 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OU685_RS03945 (812419) | 812419..814152 | + | 1734 | WP_000813392.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16164.10 Da Isoelectric Point: 10.2118
>T265682 WP_000244755.1 NZ_CP113364:809680-810093 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SJP5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |