Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 286210..287001 | Replicon | chromosome |
Accession | NZ_CP113364 | ||
Organism | Salmonella enterica subsp. enterica strain KNP01 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | C0Q119 |
Locus tag | OU685_RS01325 | Protein ID | WP_000369560.1 |
Coordinates | 286483..287001 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q57IR1 |
Locus tag | OU685_RS01320 | Protein ID | WP_001275017.1 |
Coordinates | 286210..286479 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU685_RS01300 (281791) | 281791..282459 | + | 669 | WP_000617729.1 | cell division ATP-binding protein FtsE | - |
OU685_RS01305 (282452) | 282452..283507 | + | 1056 | WP_001081707.1 | permease-like cell division protein FtsX | - |
OU685_RS01310 (283753) | 283753..284607 | + | 855 | WP_000159621.1 | RNA polymerase sigma factor RpoH | - |
OU685_RS01315 (284929) | 284929..286032 | + | 1104 | WP_001528146.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
OU685_RS01320 (286210) | 286210..286479 | + | 270 | WP_001275017.1 | DUF1778 domain-containing protein | Antitoxin |
OU685_RS01325 (286483) | 286483..287001 | + | 519 | WP_000369560.1 | GNAT family N-acetyltransferase | Toxin |
OU685_RS01330 (286998) | 286998..287381 | - | 384 | WP_000778873.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
OU685_RS01335 (287803) | 287803..288912 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
OU685_RS01340 (288972) | 288972..289898 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
OU685_RS01345 (289895) | 289895..291172 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
OU685_RS01350 (291169) | 291169..291936 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19414.16 Da Isoelectric Point: 8.9619
>T265679 WP_000369560.1 NZ_CP113364:286483-287001 [Salmonella enterica subsp. enterica]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5BA59 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I8URP5 |